help  | about  | cite  | software

Sequence :

Length  67 Residues  MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYS
MD5 Checksum  239517f6bf4338fb736c97b72218304b