help  | about  | cite  | software

Sequence :

Length  129 Residues  MVVCVQRTQVQAGPIKDQCMAAAGITAQDVANRHETDDPGHSVKCFFRCFLENIGIIADNQIIPGAFDRVLGHIVTAEAVERMEATCNMIKSETSHDESCEFAWQISECYEGVRLSDVKKGQRTRNHRG