help  | about  | cite  | software

Sequence :

Length  95 Residues  MGITLFRLASFTPKLKELRIILDPKGDTSKGVREYVERFYPNLKKSNPDLPILVRECSGVQPRLYARYGNGKEVSLSLANHAAPDIHKNLEAVGK